PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03209.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 368aa    MW: 41567.6 Da    PI: 6.0829
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03209.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.35.5e-083163492154
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              k +yp++e++++L +++gL+ +q+ +WF N+R +
  Rsa1.0_03209.1_g00002.1 316 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 349
                              579*****************************87 PP

2ELK26.91.1e-09270291122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELKh+L+++++++++++++E++
  Rsa1.0_03209.1_g00002.1 270 ELKHELKQGFKEKIVDIREEIM 291
                              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.7E-18105149IPR005540KNOX1
PfamPF037905.2E-17107148IPR005540KNOX1
SMARTSM012568.1E-25156211IPR005541KNOX2
PfamPF037913.9E-18161210IPR005541KNOX2
PROSITE profilePS512139.446270290IPR005539ELK domain
SMARTSM011886.2E-4270291IPR005539ELK domain
PfamPF037892.8E-6270291IPR005539ELK domain
PROSITE profilePS5007112.066290353IPR001356Homeobox domain
SMARTSM003899.6E-11292357IPR001356Homeobox domain
SuperFamilySSF466895.13E-16292357IPR009057Homeodomain-like
CDDcd000861.10E-11293349No hitNo description
Gene3DG3DSA:1.10.10.604.9E-25297355IPR009057Homeodomain-like
PfamPF059201.4E-17310349IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009727Biological Processdetection of ethylene stimulus
GO:0071369Biological Processcellular response to ethylene stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MSFNSSHLIP PQEDLPLRHF SDQPHQQPQP HLTETPTLLT ASFLNLPFNA GTTADSDFAP  60
PHPGGDSSAA ATNRRWLSFN SEIQNTGEGH PEEVIDGVNE DWKSASCKAA IVRHPMFEQL  120
LAAHVACLRV ATPVDQIPRI DAQLSELHTV AAKYSTLGVD VDNKELDHFL SHYVVLLCSF  180
KEQLQHHVCV HAMEAITACW EIEQSLQSIT GVSPSESNGK TMSDDEDDNQ VESEVNMFDG  240
SLDGSDCMMG FGPLVPTERE RSLLERVKKE LKHELKQGFK EKIVDIREEI MRKRRAGKLP  300
GDTTSVLKEW WQTHAKWPYP TEEDKAKLVQ ETGLQLKQIN NWFINQRKRN WNNNSSTSST  360
LSKNKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1346367RKRNWNNNSSTSSTLSKNKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525800.0AK352580.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-I15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126429.10.0PREDICTED: homeobox protein knotted-1-like 5 isoform X1
SwissprotP480020.0KNAT5_ARATH; Homeobox protein knotted-1-like 5
TrEMBLA0A078BWZ90.0A0A078BWZ9_BRANA; BnaC01g06410D protein
STRINGBra011317.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32040.10.0KNOTTED1-like homeobox gene 5